EMBL-EBI | Chemical Biology | ChEBI
Example searches: iron*, InChI=1S/CH4O/c1-2/h2H,1H3, caffeine | Advanced Search
| Formula | (C2H2NOR)n.C2H5N2OR |
| Net Charge | 0 |
| SMILES | *[C@H](N)C(=O)N[C@@H](*)C(N)=O |
| Roles Classification |
|---|
| Chemical Role: | Bronsted base A molecular entity capable of accepting a hydron from a donor (Brønsted acid). |
| ChEBI Ontology |
|---|
| Outgoing Relation(s) |
| peptidyl amide (CHEBI:15722) is a peptide (CHEBI:16670) |
| peptidyl amide (CHEBI:15722) is conjugate base of peptidylamide(1+) (CHEBI:136962) |
| Incoming Relation(s) |
| Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 (CHEBI:138169) is a peptidyl amide (CHEBI:15722) |
| corticotropin-releasing hormone (human) (CHEBI:65312) is a peptidyl amide (CHEBI:15722) |
| corticotropin-releasing hormone (ovine) (CHEBI:65307) is a peptidyl amide (CHEBI:15722) |
| dermaseptin s3(1-16)-NH2 (CHEBI:82640) is a peptidyl amide (CHEBI:15722) |
| gastrin-14 (CHEBI:75451) is a peptidyl amide (CHEBI:15722) |
| JNK inhibitor I (CHEBI:88340) is a peptidyl amide (CHEBI:15722) |
| kisspeptin-54 (CHEBI:80304) is a peptidyl amide (CHEBI:15722) |
| lixisenatide (CHEBI:85662) is a peptidyl amide (CHEBI:15722) |
| mastoparan (CHEBI:78496) is a peptidyl amide (CHEBI:15722) |
| mastoparan-A (CHEBI:78509) is a peptidyl amide (CHEBI:15722) |
| mastoparan-AF (CHEBI:78507) is a peptidyl amide (CHEBI:15722) |
| mastoparan-B (CHEBI:78511) is a peptidyl amide (CHEBI:15722) |
| mastoparan-D (CHEBI:78514) is a peptidyl amide (CHEBI:15722) |
| mastoparan-M (CHEBI:78518) is a peptidyl amide (CHEBI:15722) |
| mastoparan-V (CHEBI:78519) is a peptidyl amide (CHEBI:15722) |
| melittin (CHEBI:6736) is a peptidyl amide (CHEBI:15722) |
| peptide YY (CHEBI:80330) is a peptidyl amide (CHEBI:15722) |
| QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 (CHEBI:84736) is a peptidyl amide (CHEBI:15722) |
| tetragastrin (CHEBI:137728) is a peptidyl amide (CHEBI:15722) |
| ω-conotoxin GVIA (CHEBI:90630) is a peptidyl amide (CHEBI:15722) |
| peptidylamide(1+) (CHEBI:136962) is conjugate acid of peptidyl amide (CHEBI:15722) |
| Synonym | Source |
|---|---|
| peptidyl amides | ChEBI |
| Manual Xrefs | Databases |
|---|---|
| C02179 | KEGG COMPOUND |
| PEPTIDAMIDE-CPD | MetaCyc |