CHEBI:15722 - peptidyl amide

ChEBI IDCHEBI:15722
ChEBI Namepeptidyl amide
Stars
DefinitionA peptide that has a carbamoyl group at the C-terminus.
Secondary ChEBI IDsCHEBI:8007, CHEBI:14762
Last Modified28 March 2018
DownloadsMolfile
Formula(C2H2NOR)n.C2H5N2OR
Net Charge0
SMILES*[C@H](N)C(=O)N[C@@H](*)C(N)=O
Roles Classification
Chemical Role:
Bronsted base  A molecular entity capable of accepting a hydron from a donor (Brønsted acid).
ChEBI Ontology
Outgoing Relation(s)
peptidyl amide (CHEBI:15722) is a peptide (CHEBI:16670)
peptidyl amide (CHEBI:15722) is conjugate base of peptidylamide(1+) (CHEBI:136962)
Incoming Relation(s)
Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 (CHEBI:138169) is a peptidyl amide (CHEBI:15722)
corticotropin-releasing hormone (human) (CHEBI:65312) is a peptidyl amide (CHEBI:15722)
corticotropin-releasing hormone (ovine) (CHEBI:65307) is a peptidyl amide (CHEBI:15722)
dermaseptin s3(1-16)-NH2 (CHEBI:82640) is a peptidyl amide (CHEBI:15722)
gastrin-14 (CHEBI:75451) is a peptidyl amide (CHEBI:15722)
JNK inhibitor I (CHEBI:88340) is a peptidyl amide (CHEBI:15722)
kisspeptin-54 (CHEBI:80304) is a peptidyl amide (CHEBI:15722)
lixisenatide (CHEBI:85662) is a peptidyl amide (CHEBI:15722)
mastoparan (CHEBI:78496) is a peptidyl amide (CHEBI:15722)
mastoparan-A (CHEBI:78509) is a peptidyl amide (CHEBI:15722)
mastoparan-AF (CHEBI:78507) is a peptidyl amide (CHEBI:15722)
mastoparan-B (CHEBI:78511) is a peptidyl amide (CHEBI:15722)
mastoparan-D (CHEBI:78514) is a peptidyl amide (CHEBI:15722)
mastoparan-M (CHEBI:78518) is a peptidyl amide (CHEBI:15722)
mastoparan-V (CHEBI:78519) is a peptidyl amide (CHEBI:15722)
melittin (CHEBI:6736) is a peptidyl amide (CHEBI:15722)
peptide YY (CHEBI:80330) is a peptidyl amide (CHEBI:15722)
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 (CHEBI:84736) is a peptidyl amide (CHEBI:15722)
tetragastrin (CHEBI:137728) is a peptidyl amide (CHEBI:15722)
ω-conotoxin GVIA (CHEBI:90630) is a peptidyl amide (CHEBI:15722)
peptidylamide(1+) (CHEBI:136962) is conjugate acid of peptidyl amide (CHEBI:15722)
Synonym  Source
peptidyl amidesChEBI
Manual XrefsDatabases
C02179KEGG COMPOUND
PEPTIDAMIDE-CPDMetaCyc