EMBL-EBI | Chemical Biology | ChEBI
Example searches: iron*, InChI=1S/CH4O/c1-2/h2H,1H3, caffeine | Advanced Search
CHEBI:80304 - kisspeptin-54
| ChEBI ID | CHEBI:80304 |
| ChEBI Name | kisspeptin-54 |
| Stars | |
| Definition | A 65-membered peptide hormone consisting of Gly, Thr, Ser, Leu, Ser, Pro, Pro, Pro, Glu, Ser, Ser, Gly, Ser, Arg, Gln, Gln, Pro, Gly, Leu, Ser, Ala, Pro, His, Ser, Arg, Gln, Ile, Pro, Ala, Pro, Gln, Gly, Ala, Val, Leu, Val, Gln, Arg, Glu, Lys, Asp, Leu, Pro, Asn, Tyr, Asn, Trp, Asn, Ser, Phe, Gly, Leu, Arg and Phe-NH2 residues joined in sequence. |
| Last Modified | 11 August 2017 |
| Wikipedia |
|---|
| Species of Metabolite | Component | Source | Comments |
|---|---|---|---|
| Homo sapiens (ncbitaxon:9606) | - | PubMed (26089302) |
| Roles Classification |
|---|
| Chemical Roles: | Bronsted base A molecular entity capable of accepting a hydron from a donor (Brønsted acid). Bronsted base A molecular entity capable of accepting a hydron from a donor (Brønsted acid). |
| Biological Roles: | human metabolite Any mammalian metabolite produced during a metabolic reaction in humans (Homo sapiens). hormone Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds. |
| ChEBI Ontology |
|---|
| Outgoing Relation(s) |
| kisspeptin-54 (CHEBI:80304) has role human metabolite (CHEBI:77746) |
| kisspeptin-54 (CHEBI:80304) is a peptide hormone (CHEBI:25905) |
| kisspeptin-54 (CHEBI:80304) is a peptidyl amide (CHEBI:15722) |
| kisspeptin-54 (CHEBI:80304) is a polypeptide (CHEBI:15841) |
| Synonyms | Source |
|---|---|
| Metastin | KEGG COMPOUND |
| GYSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKALPAYNWNSFGLRF-NH2 | ChEBI |
| Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 | ChEBI |
| Kisspeptin | KEGG COMPOUND |
| Manual Xrefs | Databases |
|---|---|
| C16090 | KEGG COMPOUND |
| Kisspeptin | Wikipedia |
| Registry Numbers | Sources |
|---|---|
| Reaxys:24324304 | Reaxys |
| Citations |
|---|