EMBL-EBI | Chemical Biology | ChEBI
Example searches: iron*, InChI=1S/CH4O/c1-2/h2H,1H3, caffeine | Advanced Search
CHEBI:80330 - peptide YY
| ChEBI ID | CHEBI:80330 |
| ChEBI Name | peptide YY |
| Stars | |
| Definition | A 36-membered human gut polypeptide consisting of Tyr, Pro, Ile, Lys, Pro, Glu, Ala, Pro, Gly, Glu, Asp, Ala, Ser, Pro, Glu, Glu, Leu, Asn, Arg, Tyr, Tyr, Ala, Ser, Leu, Arg, His, Tyr, Leu, Asn, Leu, Val, Thr, Arg, Gln, Arg and Tyr-NH2 residues joined in sequence. |
| Last Modified | 11 August 2017 |
| Wikipedia |
|---|
| Roles Classification |
|---|
| Chemical Roles: | Bronsted base A molecular entity capable of accepting a hydron from a donor (Brønsted acid). Bronsted base A molecular entity capable of accepting a hydron from a donor (Brønsted acid). |
| Biological Roles: | human metabolite Any mammalian metabolite produced during a metabolic reaction in humans (Homo sapiens). neuropeptide Y2 receptor agonist An agonist that binds to and activates neuropeptide Y2 receptors. hormone Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds. |
| Application: | appetite depressant Any agent that is used to decrease appetite. |
| ChEBI Ontology |
|---|
| Outgoing Relation(s) |
| peptide YY (CHEBI:80330) has role appetite depressant (CHEBI:50507) |
| peptide YY (CHEBI:80330) has role human metabolite (CHEBI:77746) |
| peptide YY (CHEBI:80330) has role neuropeptide Y2 receptor agonist (CHEBI:138168) |
| peptide YY (CHEBI:80330) is a peptide hormone (CHEBI:25905) |
| peptide YY (CHEBI:80330) is a peptidyl amide (CHEBI:15722) |
| peptide YY (CHEBI:80330) is a polypeptide (CHEBI:15841) |
| Synonyms | Source |
|---|---|
| Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 | ChEBI |
| YPIKPEAPGEDASPEELNYYASLRHYLNLVTRQRY-NH2 | ChEBI |
| PYY 3-36 | ChEBI |
| PYY3-36 | ChEBI |
| PYY (3-36) | ChEBI |
| peptide tyrosine tyrosine | ChEBI |
| Manual Xrefs | Databases |
|---|---|
| C16118 | KEGG COMPOUND |
| Peptide_YY | Wikipedia |
| Registry Numbers | Sources |
|---|---|
| Reaxys:9754261 | Reaxys |
| CAS:1366182-03-7 | ChemIDplus |
| Citations |
|---|