Sequence for MER0825859

>MER0825859 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 131-297 ( active site residue(s): 252 metal ligand(s): 251,255,261 ) (Ophiophagus hannah) (Source: UniProt V8P548) 
1        MERRQRGCCGVSAWGCRRLLPFLSALLCAYGDTSVGPVGTGSSELPAMVGASWLKTYGYL       60
61       LPSDTRMSALLSGKVMQSAVTTMQQFYGIPVTGVLDHTTIEWMKKPRCGVPDHPHLSHRR      120
121      RIKRYALTGQKWRQKHITYSVHNYTPKVGELDTRKAIRQAFDVWQRVTPLTFEEVPYHEI      180
181      KSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNSNH      240
241      DGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAE      300
301      PLEPTRPLPTLPVRRIHSTSERKHDRHSRPPRPPLGDRPSAPGSKPNICDGNFNTVALFR      360
361      GEMFVFKDRWFWRLRNSRVQEGYPMQIEQFWKGLPAKIDAAYERSDGKFVFFKGDKYWVF      420
421      KEVTAEPGYPHSLVELGSCLPREGIDTALRWEPVGKTYFFKGDKYWRYNEDKRATDPGYP      480
481      KPITVWKGIPQAPQGAFVSKEGFYTYFYKGKEYWKFDNQRLTVEPGYPRSILKDWMGCNQ      540
541      KEVERSKDRRLSHDDVDIMVTINDVPSTVNAIAVVIPCILSLCILVLVYTIFQFKNKEVQ      600
601      QSVTYYRRPVQEWV                                                    614