Sequence for MER0825256

>MER0825256 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 88-254 ( active site residue(s): 209 metal ligand(s): 208,212,218 ) (Podiceps cristatus) (Source: UniProt A0A094L854) 
1        TICFFLFQGWLKTYGYFLPSDSQISALQSGKAVQSAVATMQQFYGIPVTGVLDQITIEWM       60
61       KKPRCGVPDHPQLRHSRRKKRYALTGQKWRQKHITYSVHNYTPKVGEIDTRRAIRQAFDV      120
121      WQRVTPLTFEEVPYHEIKNDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGG      180
181      DTHFDSDEPWTLGNSNHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKL      240
241      PQDDLQGIQKIYGPPVEPLEPTRPLPTLPVRRIHSTSERKHERQPRPPSPPLGDRPSPPG      300
301      MKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPAKIDAAYE      360
361      RSDGKFVFFKGDKYWVFKEVTAEPGYPHSLVELGSCLPREGIDTALRWEPVGKTYFFKGD      420
421      RYWRYNEDKRATDPGYPKPITVWRGIPQAPQGAFISKEGFYTYFYKGKEYWKFDNQRLSV      480
481      EPGYPRSILKDWMGCNQKDVERSKDRRLPHDDVDIMVTINDVPSTVNAIAVVIPCILSLC      540
541      ILVLVYTIFQFKNKEVQQNIVYYKRPVQEWV                                   571