Sequence for MER0452300

>MER0452300 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 55-230 ( active site residue(s): 186 metal ligand(s): 185,189,195 ) (Tyto alba) (Source: ProtID XP_009968667) 
1        MSALQSGKAVQSAVATMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLRHSRRKKRYA       60
61       LTGQKWRQKHITYSVHNYTPKVGEIDTRRAIRQAFDVWQRVTPLTFEEVPYHEIKNDRKE      120
121      ADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNSNHDGNDLF      180
181      LVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPVEPLEPTR      240
241      PLPTLPVRRIHSTSERKHERQPRPPSPPLGDRPSPPGMKPNICDGNFNTVALFRGEMFVF      300
301      KDRWFWRLRNNRVQEGYPMQIEQFWKGLPAKIDAAYERSDGKFVFFKGDKYWVFKEVTAE      360
361      PGYPHSLVELGNCLPREGIDTALRWEPVGKTYFFKGDRYWRYNEDKRATDPGYPKPITVW      420
421      RGIPQAPQGAFISKEGFYTYFYKGKEYWKFDNQRLSVEPGYPRSILKDWMGCNQKDVERS      480
481      KDRRLPHDDVDIMVTINDVPSTVNAIAVVIPCILSLCILVLVYTIFQFKNKEVQQNVVYY      540
541      KRPVQEWV                                                          548