Sequence for MER0342077

>MER0342077 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 248-351 (Sus scrofa) (Source: ProtID XP_003360009) 
1        MLVLTVSGLYQDYALGLGPPTRDILPSQPRRDSISKTIYLASSPSLRAAPRAPFLQFHPF       60
61       GPCLQKQFFWPLRPPPQRRSSACVPGLPDSRQPGGSGLGAAPAPLAAPSRGGARGGGGAL      120
121      AAEAAAAAKTGGPGACPRRGDSAAPQPLQREDPAGAAAAAAIAAWAARNWLKSYGYLLPY      180
181      DSRASALHSGKALQSAVATMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNK      240
241      RYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSD      300
301      RKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDAP      360
361      FLQPQNPFPYVLDVFPGFLNTYTWSYSWISVNEWRSVLTDNLALPQQKASPKLLANLALV      420
421      LPIPPTLKALVVSAEQAAGMHLCDQVCPSGLFSLPKTLARRATHNSSLTWPHGALSRVGT      480
481      ERCRTAEAPPAPGSLKMTTSPPPPGFPSAHPTPSALVQTLILASRQTLVISLPLVSSPSN      540
541      PSSHCSQSDFIVSPPPLLLKLPTGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPR      600
601      PPLGDRPASPGAKPNICDGNFNTVALFRGEMFVFK                               635