Sequence for MER0329796

>MER0329796 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 90-266 ( active site residue(s): 211 metal ligand(s): 210,214,220 ) (Pteropus alecto) (Source: ProtID ELK04130) 
1        MHPFLSYVFQNWLKSYGYLLPYDSRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIE       60
61       WMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAF      120
121      DVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGI      180
181      GGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNF      240
241      KLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPST      300
301      PGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAA      360
361      YERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFK      420
421      GERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKL      480
481      SVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILS      540
541      LCILVLVYTIFQFKNKAGPQPVTYYKRPVQEWV                                 573