Sequence for MER0262916

>MER0262916 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 39-214 ( active site residue(s): 170 metal ligand(s): 169,173,179 ) (Sorex araneus) (Source: ProtID XP_004612597) 
1        MQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIH       60
61       NYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSS      120
121      PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHS      180
181      NDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSER      240
241      KHERQPRPPRPPLGDRPSMPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEG      300
301      YPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPR      360
361      EGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEG      420
421      YYTYFYKGRDYWKFDNQKLSVEPGYPRSILRDWMGCNQKEVERRKERRLPQDDVDIMVTI      480
481      NDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKAGPQPVTYYKRPVQEWV              532