Sequence for MER0213832

>MER0213832 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 68-307 ( active site residue(s): 156,245,302  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MRRLVSCSIAVLALCAALLTAPTAAAAPGSAILDVRPLGGRQLEVVVHSAAMNRPITLWM       60
61       SHPGPGAPALYLLNAVDGGEDGGPWMNRTDVAAFFADKNVNVIVPMGGRASYYTDWVADD      120
121      PVLGRNKWSTFLTAELPPLLEQRFGMTGRNAVAGLSMSATSALNLALDAPGRYQAVGAYS      180
181      GCARTSDPAGRALIYAELAVFGANATNMWGGPDSPLWAAHDPVLRAEELRGLAIYVSAGD      240
241      GRPGRHETLTAPGIDGNPLDLVERTVVGGLMETVIGACTRPLVDRLTSLAVPATLALRPG      300
301      THSWPYWQDDLHDSWPMFAAAIGA                                          324