Sequence for MER0211280

>MER0211280 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 71-331 ( active site residue(s): 188,284,326  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MRGRRARGWFQRALLLSMAVLMPLGVTVAGGGATASAAFNPDGFDFWVDSDMGPIKSRIF       60
61       RAADGNTNRVVYALDGMRARNDLSGWEIDTEVARELTKWNINVVMPVGGMSSFYADWNAP      120
121      STILGIGGGSSGSASGSSSGSGALQMFAGGPGKSTRYTWETFLTNNLRWALRDRLGFNPN      180
181      RNGVFGLSMGGSAALTLAAYHPDQFSYAGSYSGYLNVSAPGMREALRVAMIDAGGYNIDA      240
241      MAPPWGPQWLRMDPFVFAPRLKANNTRLWISAGSGLPGPADGFNFGTVNAMGLEVLALAN      300
301      TRAFQVRMATLGANNVTYDFPAVGVHNWRYWETEVYRMIPDLSANIG                   347