Sequence for MER0211245

>MER0211245 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 71-302 ( active site residue(s): 159,246,297  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MRRRRIAGAVLAAVLAVLGPLVAVQAPASAAQVVRVDELSPTRSAVFVDSPAMGRVIQVQ       60
61       VLHPAGGAARPSYYLLDGLDPGVGQSTWTNATDAEAFFRGKNVNVVLPVGGQASYYTDWQ      120
121      TDDPKFGRYKWETFLTRELPPIIDAQFAGNGVNGIGGLSMGGNAAYILAARNPHLYTAVA      180
181      GYSACPDTGLATGAVMFSIANRGGNPLNMWGPPGSPAWAEHDPARLAGNLRGKTLYLSTG      240
241      TGIPGPHEAELKPQLAENIFLGGPVEVGVNICTVAFEQRLRGLGIPARIDYSPVGTHSWS      300
301      YWQDTLHASWSTIGRALGA                                               319