Sequence for MER0102126

>MER0102126 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 80-255 ( active site residue(s): 211 metal ligand(s): 210,214,220 ) (Myotis lucifugus) (Source: ProtID XP_006089512) 
1        MHPFLSHVFQNWLKSYGYLLPYDSRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIE       60
61       WMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAF      120
121      DVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGI      180
181      GGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNF      240
241      KLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPST      300
301      PGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAA      360
361      YERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFK      420
421      GEQYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKL      480
481      SVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDMPGSVNAVAVVIPCILS      540
541      LCILVLVYTIFQFKNKAGPQPVTYYKRPVQEWV                                 573