Sequence for MER0098657

>MER0098657 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 173-363 ( active site residue(s): 304 metal ligand(s): 303,307,313 ) (Equus caballus) (Source: ProtID XP_001499275) 
1        MRTWPHFWPWEEASQELEKSDIPVLIQNPKCATSLGMVIVWLVVASWVWAKDIVQSAREF       60
61       PLVHLLPTQELVAAKRQRCTIKVFVKKLRRALWAILKALFRLANWLKSYGYLLPYDSRAS      120
121      ALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALT      180
181      GQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEAD      240
241      IMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLV      300
301      AVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPL      360
361      PTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGAKPNICDGNFNTVALFRGEMFVFKD      420
421      RWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPG      480
481      YPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKG      540
541      IPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKE      600
601      RRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKAGPQPVTYYKR      660
661      PVQEWV                                                            666