Sequence for MER0076166

>MER0076166 - L,D-transpeptidase ({Enterococcus}-type) [C82.001] peptidase unit: 217-466 ( active site residue(s): 421,442  ) (Enterococcus faecium) (Source: MEROPS) 
1        MTRSSHRKKSKHVALLSVLGVLLVLISFYTYRSTYYTKHFLPNTEINGINVSNLTVEKAN       60
61       EKLKEAYSDKKLAIKEDGKVWQEVPKSELGYKDDFTSELSPILNEQNGWTWGMTYVSAAE      120
121      KQEIDPVSQNHQKLDTTVQTLTTKLTDLNKDRTPTTDATIEKAGDSFVIKPEVNGNTIDV      180
181      DAAVKQLKSAVNSGKDTIELTEFKEKPKVTSEDSSLKEQLASMNAIANVKATYSINGETF      240
241      QIPSSDIMSWLTYNDGKVDLDTEQVRQYVTDLGTKYNTSTNDTKFKSTKRGEVTVPVGTY      300
301      SWTIQTDSETEALKKAILAGQDFTRSPIVQGGTTADHPLIEDTYIEVDLENQHMWYYKDG      360
361      KVALETDIVSGKPTTPTPAGVFYVWNKEEDATLKGTNDDGTPYESPVNYWMPIDWTGVGI      420
421      HDSDWQPEYGGDLWKTRGSHGCINTPPSVMKELFGMVEKGTPVLVF                    466