Sequence for MER0041255

>MER0041255 - 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase ({Burkholderia}-type) [S33.016] peptidase unit: 17-280 ( active site residue(s): 113,240,268  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTSTAELTYESTSRYAQVRPDLKLHYHEAGVGNGPTIVLLHGGGPGASSWSNFARNIPVL       60
61       AQNFHVLAVDQPGFGRSDKPVDHPQYFSHSAAALKDLLDTLGVTERVHLLGNSLGGGAAV      120
121      RFALDYPDRAGKLVLMGPGGLSMNAYAPDPTEGVKLLSRFNFEPTRQNLEAFLRIMVFDQ      180
181      KLITDELIDERFASAATPEALAATRAMGKSFAGPDFELGMLWRDAYKLRQPVLLIWGRED      240
241      RVNPLDGAIVATKMIPRVQLHVFGGCGHWAQLEKFDEFNRLATDFLSGPGKES             293