Sequence for MER0041201

>MER0041201 - subfamily S1C unassigned peptidases [S01.UPC] peptidase unit: 245-411 ( active site residue(s): 261,298,378  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTTESQHNGPVSDTRTAAGDTSDSAADRGNLRPPDAPVLGPRPVYRPHVDSHTAHAFRRP       60
61       AGQRGSFAERPPAPQTGDQAGDRLTQNRPPDAVLAEAFGRPEGSDELLQRDPDAADAAPA      120
121      PPAPADPWRDPNSGARLGAPAVATPQPEPLPASRKLTAREVLFGARVAPKALALLAAVAL      180
181      AIGVVGGLVGRLTAETSTNLTSRKVTLEQTESTDQPHGQIAQVANAVLPSVVSIRTTVGE      240
241      NGSTGSGVVIDGAGYIVTNNHVISMAAQDKSGRASIQVTFSDGSRVPANIVGRDPKTDLA      300
301      VLKVDVKNLTVARLGRSDDVQVGDDVLAIGSPLGLSKTVTSGIVSALHRPVKLSGEGSDT      360
361      NAVIDAVQTDASINPGNSGGALVDMDGQVIGINSAIRSETGGSVGLGFAIPVDTMTEVAQ      420
421      SLIRDGVMHHPMIGLSARTKTVANEVMSGAAVADVAPGGPADKAGIVEGDVIVKVGDREV      480
481      TGPEELTVAVQAREIGETVTVTLIRDGRQVDVPVTLESD                           519