Sequence for MER0041192

>MER0041192 - acetylornithine deacetylase ArgE [M20.974] peptidase unit: 1-366 ( active site residue(s): 72,131 metal ligand(s): 70,101,132,160,340 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTIDLSADPIALTAALVDIPSVSLDERAIADVVERALREQTTGFEVLRHGNVVLARTRRG       60
61       LPTRVILAGHLDTVPIADNVPSRFGTGPDGEQLLHGCGTVDMKSGDAVFLHLAATVTDPV      120
121      HDLTLIFYDGEEIAAEYNGLGHIERDLPEWLDGDLAVLGEPSGGWIEAGCQGTLRVRLRT      180
181      AGVRAHSARAWMGDNAIHRLAPVLARLADYRARQVDIDGCVYREGLSAVAVRGGVAGNVI      240
241      PDVGEVDVNFRFAPDRDLDQAIAHVREVFAGLEVEFEVTDAAPGALPGLTAPAAKALVES      300
301      VNAHGGGGVRAKYGWTDVSRFAARGIPAVNFGPGDPNLAHKRDEHVPTAQITAVTAMLRA      360
361      YLTGAV                                                            366