Sequence for MER0029693

>MER0029693 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 1-65 ( active site residue(s): 10 metal ligand(s): 9,13,19 ) (Danio rerio) (Source: ProtID CAE51058) 
1        NDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPLDDLQGIQKIYAMLEPTR       60
61       PLPTFPARRPHSTSERKHERQSRPGRPSAGDRPSSPGHGKPNICDGNFNTVAFFRREMFV      120
121      FKDRWFWRLRNNKVQEGYPMLIDHFWKGLPHRIDAAYERSDGKFVFFKGDKYWIFKEVTA      180
181      EPGYPHSLVELGSYLPSDGIDTALRWESVGKTYFFKGDQYWRYNEEKRTTDPGYPKPIGI      240
241      WKGIPDAPQGAFVSREGFYTYFYKGKDYWKFDNQKLTVEPGYPKSILKDWMGCDQSEVEK      300
301      NKDRHLPHDDVDIMVAINDVPSTVNAIAVVIPCILSLCILVLVYTIFQFKNKNVQQHVTY      360
361      YKHPVQEWV                                                         369