CHEBI:80304 - kisspeptin-54

Main ChEBI Ontology Automatic Xrefs Reactions Pathways Models
ChEBI Name kisspeptin-54
ChEBI ID CHEBI:80304
Definition A 65-membered peptide hormone consisting of Gly, Thr, Ser, Leu, Ser, Pro, Pro, Pro, Glu, Ser, Ser, Gly, Ser, Arg, Gln, Gln, Pro, Gly, Leu, Ser, Ala, Pro, His, Ser, Arg, Gln, Ile, Pro, Ala, Pro, Gln, Gly, Ala, Val, Leu, Val, Gln, Arg, Glu, Lys, Asp, Leu, Pro, Asn, Tyr, Asn, Trp, Asn, Ser, Phe, Gly, Leu, Arg and Phe-NH2 residues joined in sequence.
Stars This entity has been manually annotated by the ChEBI Team.
Wikipedia License
Waiting for wikipedia content
Read full article at Wikipedia
Metabolite of Species Details
Homo sapiens (NCBI:txid9606) See: PubMed
Roles Classification
Chemical Role(s): Bronsted base
A molecular entity capable of accepting a hydron from a donor (Bronsted acid).
(via organic amino compound )
Biological Role(s): human metabolite
Any mammalian metabolite produced during a metabolic reaction in humans (Homo sapiens).
hormone
Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds.
(via peptide hormone )
View more via ChEBI Ontology
ChEBI Ontology
Outgoing kisspeptin-54 (CHEBI:80304) has role human metabolite (CHEBI:77746)
kisspeptin-54 (CHEBI:80304) is a peptide hormone (CHEBI:25905)
kisspeptin-54 (CHEBI:80304) is a peptidyl amide (CHEBI:15722)
kisspeptin-54 (CHEBI:80304) is a polypeptide (CHEBI:15841)
Synonyms Sources
Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 ChEBI
GYSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKALPAYNWNSFGLRF-NH2 ChEBI
Kisspeptin KEGG COMPOUND
Metastin KEGG COMPOUND
Manual Xrefs Databases
C16090 KEGG COMPOUND
Kisspeptin Wikipedia
View more database links
Registry Number Type Source
24324304 Reaxys Registry Number Reaxys
Citations Waiting for Citations Types Sources
25036713 PubMed citation Europe PMC
25995272 PubMed citation Europe PMC
26089302 PubMed citation Europe PMC
26192876 PubMed citation Europe PMC
26572695 PubMed citation Europe PMC
26973595 PubMed citation Europe PMC
27065948 PubMed citation Europe PMC
27246282 PubMed citation Europe PMC
27379743 PubMed citation Europe PMC
27589480 PubMed citation Europe PMC
27616469 PubMed citation Europe PMC
27990162 PubMed citation Europe PMC
28112678 PubMed citation Europe PMC
28393578 PubMed citation Europe PMC
28458903 PubMed citation Europe PMC
28490208 PubMed citation Europe PMC
28636637 PubMed citation Europe PMC
28746808 PubMed citation Europe PMC
28754347 PubMed citation Europe PMC
Last Modified
11 August 2017