GET /api/protein/UniProt/U6CQT0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "U6CQT0",
        "id": "U6CQT0_NEOVI",
        "source_organism": {
            "taxId": "452646",
            "scientificName": "Neovison vison",
            "fullName": "Neovison vison (American mink)"
        },
        "name": "Lipoyl amidotransferase LIPT1, mitochondrial",
        "description": [
            "Lipoyl amidotransferase that catalyzes the transfer of lipoyl moieties from lipoyl-protein H of the glycine cleavage system (lipoyl-GCSH) to E2 subunits of the pyruvate dehydrogenase complex (PDCE2). Unable to catalyze the transfer of octanoyl from octanoyl-GCSH to PDCE2. In vitro, it is also able to catalyze the transfer of the lipoyl group from lipoyl-AMP to the specific lysine residue of lipoyl domains of lipoate-dependent enzymes but this reaction may not be physiologically relevant"
        ],
        "length": 373,
        "sequence": "MLIPFSMKNCFQLLCNCKVPAAGFKNKVKSGLIFQSVSSDIYQNLAVEDWIHDHVNLEGKPVLFLWRNSPSVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMQNLKLVVRALKAVQPQLDIQATKRCDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDRTSLSSLLKSPYQGIRSNATASIPSIVKNLLEKDPTLTCEVLMNAIAAEYAAYHQIDNHINLINPTDETLFPGINNKARELQTWEWIYGKTPKFSINTSFNVLYEQSHLEIKIFIDIKDGRIEICNIEAPNHWLPLEICDKLNSSFIGSKFCPNEITMLTNILHRTCPEDDELHNRWNILCEKIKGIM",
        "proteome": null,
        "gene": "LIPT",
        "go_terms": [
            {
                "identifier": "GO:0036211",
                "name": "protein modification process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009249",
                "name": "protein lipoylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c31ed954e7a430bfa6effa7d5abb1606810f26b8",
        "counters": {
            "domain_architectures": 40137,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 40137
        }
    }
}