GET /api/protein/UniProt/U6CQT0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "U6CQT0",
"id": "U6CQT0_NEOVI",
"source_organism": {
"taxId": "452646",
"scientificName": "Neovison vison",
"fullName": "Neovison vison (American mink)"
},
"name": "Lipoyl amidotransferase LIPT1, mitochondrial",
"description": [
"Lipoyl amidotransferase that catalyzes the transfer of lipoyl moieties from lipoyl-protein H of the glycine cleavage system (lipoyl-GCSH) to E2 subunits of the pyruvate dehydrogenase complex (PDCE2). Unable to catalyze the transfer of octanoyl from octanoyl-GCSH to PDCE2. In vitro, it is also able to catalyze the transfer of the lipoyl group from lipoyl-AMP to the specific lysine residue of lipoyl domains of lipoate-dependent enzymes but this reaction may not be physiologically relevant"
],
"length": 373,
"sequence": "MLIPFSMKNCFQLLCNCKVPAAGFKNKVKSGLIFQSVSSDIYQNLAVEDWIHDHVNLEGKPVLFLWRNSPSVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMQNLKLVVRALKAVQPQLDIQATKRCDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDRTSLSSLLKSPYQGIRSNATASIPSIVKNLLEKDPTLTCEVLMNAIAAEYAAYHQIDNHINLINPTDETLFPGINNKARELQTWEWIYGKTPKFSINTSFNVLYEQSHLEIKIFIDIKDGRIEICNIEAPNHWLPLEICDKLNSSFIGSKFCPNEITMLTNILHRTCPEDDELHNRWNILCEKIKGIM",
"proteome": null,
"gene": "LIPT",
"go_terms": [
{
"identifier": "GO:0036211",
"name": "protein modification process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009249",
"name": "protein lipoylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c31ed954e7a430bfa6effa7d5abb1606810f26b8",
"counters": {
"domain_architectures": 40137,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 40137
}
}
}