"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"U6CQT0"	"{'domain_architectures': 40137, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 40137}"	"['Lipoyl amidotransferase that catalyzes the transfer of lipoyl moieties from lipoyl-protein H of the glycine cleavage system (lipoyl-GCSH) to E2 subunits of the pyruvate dehydrogenase complex (PDCE2). Unable to catalyze the transfer of octanoyl from octanoyl-GCSH to PDCE2. In vitro, it is also able to catalyze the transfer of the lipoyl group from lipoyl-AMP to the specific lysine residue of lipoyl domains of lipoate-dependent enzymes but this reaction may not be physiologically relevant']"	"LIPT"	"[{'identifier': 'GO:0036211', 'name': 'protein modification process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009249', 'name': 'protein lipoylation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"U6CQT0_NEOVI"	"c31ed954e7a430bfa6effa7d5abb1606810f26b8"	True	False	False	373	"Lipoyl amidotransferase LIPT1, mitochondrial"	2	""	"MLIPFSMKNCFQLLCNCKVPAAGFKNKVKSGLIFQSVSSDIYQNLAVEDWIHDHVNLEGKPVLFLWRNSPSVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMQNLKLVVRALKAVQPQLDIQATKRCDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDRTSLSSLLKSPYQGIRSNATASIPSIVKNLLEKDPTLTCEVLMNAIAAEYAAYHQIDNHINLINPTDETLFPGINNKARELQTWEWIYGKTPKFSINTSFNVLYEQSHLEIKIFIDIKDGRIEICNIEAPNHWLPLEICDKLNSSFIGSKFCPNEITMLTNILHRTCPEDDELHNRWNILCEKIKGIM"	"unreviewed"	"{'taxId': '452646', 'scientificName': 'Neovison vison', 'fullName': 'Neovison vison (American mink)'}"
