HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "S0DLP1",
"id": "APF6_GIBF5",
"source_organism": {
"taxId": "1279085",
"scientificName": "Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)",
"fullName": "Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus)"
},
"name": "O-methyltransferase apf6",
"description": [
"O-methyltransferase; part of the gene cluster that mediates the biosynthesis of the cyclic tetrapeptide apicidin F (APF) (PubMed:25058475). The non-ribosomal peptide synthetase apf1 incorporates four different amino acids to produce apicidin F: L-phenylalanine, D-pipecolic acid (D-pip), N-methoxy-L-tryptophan and L-2-aminooctanedioic acid (PubMed:25058475). L-Phenylalanine is the only proteinogenic amino acid directly used by apf1 (PubMed:24195442, PubMed:25058475). The 3 other apf1 substrates are non-proteinogenic and have to be modified by other enzymes of the cluster (PubMed:25058475). Lysine is converted to delta-1-pyrroline-5-carboxylate (P5C) which is reduced to L-pipecolic acid (L-pip) by apf3 (PubMed:25058475). L-pip is epimerized to D-pip, probably by apf1 activity, prior to incorporation (PubMed:25058475). L-Tryptophan is N-oxidyzed by one of the cytochrome P450 monooxygenases (apf7 or apf8), and further methylated at the hydroxy group by the O-methyltransferase apf6 to yield N-methoxy-L-tryptophan (PubMed:25058475). The synthesis of the fourth apf1 substrate is more complex (PubMed:25058475). The fatty acid synthase apf5 is involved in the synthesis of the octanoic acid backbone of L-2-aminooctanedioic acid by fixing one acetyl-CoA unit and three malonyl-CoA units (PubMed:25058475). Then one of the cytochrome P450 monooxygenases (apf7 or apf8) may oxidize this backbone to 2-oxooctanoic acid (PubMed:25058475). The aminotransferase apf4 is predicted to catalyze the exchange of the keto group with an amino group (PubMed:25058475). The next step would be the oxidation of 2-aminooctanoic acid by one of the cytochrome P450 monooxygenases (apf7 or apf8). The last step is the oxidation of 2-amino-8-hydroxyoctanoic acid to 2-aminooctanedioic acid is catalyzed by the FAD-dependent monooxygenase apf9 (PubMed:25058475)"
],
"length": 351,
"sequence": "MASPSTDRLHLIEYLQDPGNPDGESRERLIEACQDVIASLERPIETARKQAFLTLDHAVIRSAIKLNLFKALDKEDRPYSTQELALATTPQCNHVLLSRLLRYLATRPLRLVIETSAGFWQRTARGSVFAQDSFKSGCSMYFDACGPAFQALPTWICTPDHERLHSPFQVAYPGQGSFFKRLQEDDSMLQTFQCWMETVSRHQFCAQETIDFNEWIPDGTSDSDVVFVDVGGGTGDQAIALGYKRIGLPGRIINQDLLPISQEAEEMLRSHNIERITYNFFDEQPLKGACVYHYRQIFHDWPDADCERILRRAKDSMTASSTLLIDEVVLPETGAHWMNDHKYNGVACYST",
"proteome": "UP000016800",
"gene": "apf6",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008171",
"name": "O-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bdc835ccb83003619dd55371e507d9b3256eafa8",
"counters": {
"domain_architectures": 30676,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"profile": 1,
"pfam": 2,
"panther": 1,
"pirsf": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 30676
}
}
}
