"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S0DLP1"	"{'domain_architectures': 30676, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'profile': 1, 'pfam': 2, 'panther': 1, 'pirsf': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 30676}"	"['O-methyltransferase; part of the gene cluster that mediates the biosynthesis of the cyclic tetrapeptide apicidin F (APF) (PubMed:25058475). The non-ribosomal peptide synthetase apf1 incorporates four different amino acids to produce apicidin F: L-phenylalanine, D-pipecolic acid (D-pip), N-methoxy-L-tryptophan and L-2-aminooctanedioic acid (PubMed:25058475). L-Phenylalanine is the only proteinogenic amino acid directly used by apf1 (PubMed:24195442, PubMed:25058475). The 3 other apf1 substrates are non-proteinogenic and have to be modified by other enzymes of the cluster (PubMed:25058475). Lysine is converted to delta-1-pyrroline-5-carboxylate (P5C) which is reduced to L-pipecolic acid (L-pip) by apf3 (PubMed:25058475). L-pip is epimerized to D-pip, probably by apf1 activity, prior to incorporation (PubMed:25058475). L-Tryptophan is N-oxidyzed by one of the cytochrome P450 monooxygenases (apf7 or apf8), and further methylated at the hydroxy group by the O-methyltransferase apf6 to yield N-methoxy-L-tryptophan (PubMed:25058475). The synthesis of the fourth apf1 substrate is more complex (PubMed:25058475). The fatty acid synthase apf5 is involved in the synthesis of the octanoic acid backbone of L-2-aminooctanedioic acid by fixing one acetyl-CoA unit and three malonyl-CoA units (PubMed:25058475). Then one of the cytochrome P450 monooxygenases (apf7 or apf8) may oxidize this backbone to 2-oxooctanoic acid (PubMed:25058475). The aminotransferase apf4 is predicted to catalyze the exchange of the keto group with an amino group (PubMed:25058475). The next step would be the oxidation of 2-aminooctanoic acid by one of the cytochrome P450 monooxygenases (apf7 or apf8). The last step is the oxidation of 2-amino-8-hydroxyoctanoic acid to 2-aminooctanedioic acid is catalyzed by the FAD-dependent monooxygenase apf9 (PubMed:25058475)']"	"apf6"	"[{'identifier': 'GO:0008168', 'name': 'methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046983', 'name': 'protein dimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008171', 'name': 'O-methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"APF6_GIBF5"	"bdc835ccb83003619dd55371e507d9b3256eafa8"	True	False	False	351	"O-methyltransferase apf6"	1	"UP000016800"	"MASPSTDRLHLIEYLQDPGNPDGESRERLIEACQDVIASLERPIETARKQAFLTLDHAVIRSAIKLNLFKALDKEDRPYSTQELALATTPQCNHVLLSRLLRYLATRPLRLVIETSAGFWQRTARGSVFAQDSFKSGCSMYFDACGPAFQALPTWICTPDHERLHSPFQVAYPGQGSFFKRLQEDDSMLQTFQCWMETVSRHQFCAQETIDFNEWIPDGTSDSDVVFVDVGGGTGDQAIALGYKRIGLPGRIINQDLLPISQEAEEMLRSHNIERITYNFFDEQPLKGACVYHYRQIFHDWPDADCERILRRAKDSMTASSTLLIDEVVLPETGAHWMNDHKYNGVACYST"	"reviewed"	"{'taxId': '1279085', 'scientificName': 'Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)', 'fullName': 'Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus)'}"