General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8ZKQ5",
        "id": "LSRR_SALTY",
        "source_organism": {
            "taxId": "99287",
            "scientificName": "Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)",
            "fullName": "Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)"
        },
        "name": "Transcriptional regulator LsrR",
        "description": [
            "Transcriptional regulator that represses the expression of the lsr operon (lsrACDBFGE) in the absence of the quorum-sensing signaling molecule autoinducer 2 (AI-2) (PubMed:11722742, PubMed:14622426, PubMed:20628367). It also represses the expression of the lsrRK operon (PubMed:20628367). Acts by binding to the intergenic region between the lsr operon and lsrR (PubMed:20628367). In the presence of phosphorylated autoinducer-2 (phospho-AI-2), LsrR is inactivated, leading to the transcription of the genes (PubMed:14622426). The regulatory function of LsrR was thought to be limited to the lsr operon, but it was subsequently shown to be involved, directly or indirectly, in the regulation of SPI-1 and flagella genes (PubMed:22623980). It negatively regulates the expression of those genes, which reduces the ability of Salmonella to invade host cells (PubMed:22623980)"
        ],
        "length": 319,
        "sequence": "MSDNTLVSDYGMCEEEQVARIAWFYYHDGLTQSEISERLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYENALRNHFALQNIRVLPALPDADIGLRLGIGAAHMLMESLRPQQLLAVGFGEATMTTLKRLSGFISAQQIRLVTLSGGVGPYMTGIGQLDAACSVSIMPAPLRASSQEIACTLRNENSVRDVMLTAQAADAAIVGIGAINQKDQASILKSGYITQGEQLMIGRKGAVGDILGYFFDAHGEIIPDIKIHNELIGLKLNSLSTIPTVIGVAGGEQKAEAIIAAMRGNYINALVTDQKTAGKIIQIIEK",
        "proteome": "UP000001014",
        "gene": "lsrR",
        "go_terms": [
            {
                "identifier": "GO:0030246",
                "name": "carbohydrate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c033a5ff1ebc8c1860374ed4ac6407a1a9d3b582",
        "counters": {
            "domain_architectures": 10402,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 1,
                "ssf": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10402
        }
    }
}