"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8ZKQ5"	"{'domain_architectures': 7375, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 1, 'ssf': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7375}"	"['Transcriptional regulator that represses the expression of the lsr operon (lsrACDBFGE) in the absence of the quorum-sensing signaling molecule autoinducer 2 (AI-2) (PubMed:11722742, PubMed:14622426, PubMed:20628367). It also represses the expression of the lsrRK operon (PubMed:20628367). Acts by binding to the intergenic region between the lsr operon and lsrR (PubMed:20628367). In the presence of phosphorylated autoinducer-2 (phospho-AI-2), LsrR is inactivated, leading to the transcription of the genes (PubMed:14622426). The regulatory function of LsrR was thought to be limited to the lsr operon, but it was subsequently shown to be involved, directly or indirectly, in the regulation of SPI-1 and flagella genes (PubMed:22623980). It negatively regulates the expression of those genes, which reduces the ability of Salmonella to invade host cells (PubMed:22623980)']"	"lsrR"	"[{'identifier': 'GO:0030246', 'name': 'carbohydrate binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"LSRR_SALTY"	"c033a5ff1ebc8c1860374ed4ac6407a1a9d3b582"	True	False	319	"Transcriptional regulator LsrR"	1	"UP000001014"	"MSDNTLVSDYGMCEEEQVARIAWFYYHDGLTQSEISERLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYENALRNHFALQNIRVLPALPDADIGLRLGIGAAHMLMESLRPQQLLAVGFGEATMTTLKRLSGFISAQQIRLVTLSGGVGPYMTGIGQLDAACSVSIMPAPLRASSQEIACTLRNENSVRDVMLTAQAADAAIVGIGAINQKDQASILKSGYITQGEQLMIGRKGAVGDILGYFFDAHGEIIPDIKIHNELIGLKLNSLSTIPTVIGVAGGEQKAEAIIAAMRGNYINALVTDQKTAGKIIQIIEK"	"reviewed"	"{'taxId': '99287', 'scientificName': 'Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)', 'fullName': 'Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)'}"