General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q55215",
        "id": "DNRD_STRS5",
        "source_organism": {
            "taxId": "45212",
            "scientificName": "Streptomyces sp. (strain C5)",
            "fullName": "Streptomyces sp. (strain C5)"
        },
        "name": "Aklanonic acid methyl ester cyclase DauD",
        "description": [
            "Involved in the biosynthesis of aklavinone which is an important precursor common to the formation of the clinically significant anthracyclines such as carminomycin, daunorubicin (daunomycin), rhodomycin, aclacinomycin T (aklavin) and aclacinomycin A (aclarubicin). These compounds are aromatic polyketide antibiotics that exhibit high cytotoxicity and are widely applied in the chemotherapy of a variety of cancers. Catalyzes the cyclization of aklanonic acid methyl ester to yield aklaviketone"
        ],
        "length": 161,
        "sequence": "MSPQIDLVRRMVEAYNTGKTDDVAEFILHEYLNPGALEHNPELRGPEAFAAAVTWLKYAFSEEAHLEEIGYEENGPWVRAKLALYGRHVGNLVGMPATGRRFSGEQIHLIRIVDGKIRDHRDWPDYLGTYRQLGEPWPTPEGWRPCPPPPRRRHDRSTDTP",
        "proteome": null,
        "gene": "dauD",
        "go_terms": [
            {
                "identifier": "GO:0030638",
                "name": "polyketide metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ce198cde16387ff32ac89cbf0229788e1ace81ea",
        "counters": {
            "domain_architectures": 16702,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 16702
        }
    }
}