"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q55215"	"{'domain_architectures': 16702, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 16702}"	"['Involved in the biosynthesis of aklavinone which is an important precursor common to the formation of the clinically significant anthracyclines such as carminomycin, daunorubicin (daunomycin), rhodomycin, aclacinomycin T (aklavin) and aclacinomycin A (aclarubicin). These compounds are aromatic polyketide antibiotics that exhibit high cytotoxicity and are widely applied in the chemotherapy of a variety of cancers. Catalyzes the cyclization of aklanonic acid methyl ester to yield aklaviketone']"	"dauD"	"[{'identifier': 'GO:0030638', 'name': 'polyketide metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"DNRD_STRS5"	"ce198cde16387ff32ac89cbf0229788e1ace81ea"	True	False	False	161	"Aklanonic acid methyl ester cyclase DauD"	1	""	"MSPQIDLVRRMVEAYNTGKTDDVAEFILHEYLNPGALEHNPELRGPEAFAAAVTWLKYAFSEEAHLEEIGYEENGPWVRAKLALYGRHVGNLVGMPATGRRFSGEQIHLIRIVDGKIRDHRDWPDYLGTYRQLGEPWPTPEGWRPCPPPPRRRHDRSTDTP"	"reviewed"	"{'taxId': '45212', 'scientificName': 'Streptomyces sp. (strain C5)', 'fullName': 'Streptomyces sp. (strain C5)'}"