General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0ACZ4",
        "id": "EVGA_ECOLI",
        "source_organism": {
            "taxId": "83333",
            "scientificName": "Escherichia coli (strain K12)",
            "fullName": "Escherichia coli (strain K12)"
        },
        "name": "DNA-binding transcriptional activator EvgA",
        "description": [
            "Member of the two-component regulatory system EvgS/EvgA (PubMed:10825546, PubMed:10923791, PubMed:9535079). The EvgS/EvgA system is involved in regulating the expression of glutamate-dependent acid resistance genes, acting in concert with transcription factors YdeO and GadE (PubMed:12694615, PubMed:15489450, PubMed:17998538). Regulates the expression of emrKY and safA-ydeO operons, gadE, yfdX and probably ydeP (PubMed:10923791, PubMed:11157960, PubMed:12694615, PubMed:15489450, PubMed:17998538). Binds directly to an 18 bp consensus sequence similar to 5'-AGCCTACACCTGTAAGAA-3' in the promoter region of safA/b1500 and other target genes, including its own operon, evgAS (PubMed:12694615, PubMed:15489450, PubMed:17998538). Also may control expression of multi-drug transporter mdtEF and other multi-drug efflux systems (PubMed:11157960, PubMed:11914367). Overexpression can confer resistance to antibiotics such as beta-lactams, probably as a result of up-regulation of multi-drug efflux systems (PubMed:12951338)"
        ],
        "length": 204,
        "sequence": "MNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKIG",
        "proteome": "UP000000625",
        "gene": "evgA",
        "go_terms": [
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bf2a74b77e142e5501cae2a7fdcb5764135340de",
        "counters": {
            "domain_architectures": 202586,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "smart": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "profile": 2,
                "pfam": 2,
                "cdd": 2,
                "ncbifam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 202586
        }
    }
}