"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0ACZ4"	"{'domain_architectures': 202586, 'entries': 24, 'isoforms': 0, 'proteomes': 1, 'sets': 4, 'structures': 2, 'taxa': 1, 'dbEntries': {'smart': 2, 'ssf': 2, 'cathgene3d': 2, 'profile': 2, 'pfam': 2, 'cdd': 2, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 8}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 202586}"	"[""Member of the two-component regulatory system EvgS/EvgA (PubMed:10825546, PubMed:10923791, PubMed:9535079). The EvgS/EvgA system is involved in regulating the expression of glutamate-dependent acid resistance genes, acting in concert with transcription factors YdeO and GadE (PubMed:12694615, PubMed:15489450, PubMed:17998538). Regulates the expression of emrKY and safA-ydeO operons, gadE, yfdX and probably ydeP (PubMed:10923791, PubMed:11157960, PubMed:12694615, PubMed:15489450, PubMed:17998538). Binds directly to an 18 bp consensus sequence similar to 5'-AGCCTACACCTGTAAGAA-3' in the promoter region of safA/b1500 and other target genes, including its own operon, evgAS (PubMed:12694615, PubMed:15489450, PubMed:17998538). Also may control expression of multi-drug transporter mdtEF and other multi-drug efflux systems (PubMed:11157960, PubMed:11914367). Overexpression can confer resistance to antibiotics such as beta-lactams, probably as a result of up-regulation of multi-drug efflux systems (PubMed:12951338)""]"	"evgA"	"[{'identifier': 'GO:0000160', 'name': 'phosphorelay signal transduction system', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0043565', 'name': 'sequence-specific DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"EVGA_ECOLI"	"bf2a74b77e142e5501cae2a7fdcb5764135340de"	True	False	False	204	"DNA-binding transcriptional activator EvgA"	1	"UP000000625"	"MNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKIG"	"reviewed"	"{'taxId': '83333', 'scientificName': 'Escherichia coli (strain K12)', 'fullName': 'Escherichia coli (strain K12)'}"