General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O06522",
        "id": "CDTA_HAEDU",
        "source_organism": {
            "taxId": "233412",
            "scientificName": "Haemophilus ducreyi (strain 35000HP / ATCC 700724)",
            "fullName": "Haemophilus ducreyi (strain 35000HP / ATCC 700724)"
        },
        "name": "Cytolethal distending toxin subunit A",
        "description": [
            "CDTs are cytotoxins which induce host cell distension, growth arrest in G2/M phase, nucleus swelling, and chromatin fragmentation in HeLa cells. CdtA, along with CdtC, probably forms a heterodimeric subunit required for the delivery of CdtB"
        ],
        "length": 223,
        "sequence": "MKKFLPSLLLMGSVACSSNQRMNDYSQPESQSDLAPKSSTIQPQPQPLLSKTPSMSLNLLSSSGPNRQVLPSEPSNFMTLMGQNGALLTVWALAKRNWLWAYPNIYSQDFGNIRNWKMEPGKHREYFRFVNQSLGTCVEAYGNGLIHDICSLDKLAQEFELLPTDSGAVVIKSVSQGRCVTYNPVSTTFYSTVTLSVCDGATEPSRDQTWYLAPPVLEATAVN",
        "proteome": "UP000001022",
        "gene": "cdtA",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "300f5d9bb6e158429d722a85f63f3f0b6bfb12fd",
        "counters": {
            "domain_architectures": 759,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 759
        }
    }
}