"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"O06522"	"{'domain_architectures': 759, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 1, 'taxa': 1, 'dbEntries': {'profile': 2, 'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'pirsf': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 759}"	"['CDTs are cytotoxins which induce host cell distension, growth arrest in G2/M phase, nucleus swelling, and chromatin fragmentation in HeLa cells. CdtA, along with CdtC, probably forms a heterodimeric subunit required for the delivery of CdtB']"	"cdtA"	""	"CDTA_HAEDU"	"300f5d9bb6e158429d722a85f63f3f0b6bfb12fd"	True	False	False	223	"Cytolethal distending toxin subunit A"	1	"UP000001022"	"MKKFLPSLLLMGSVACSSNQRMNDYSQPESQSDLAPKSSTIQPQPQPLLSKTPSMSLNLLSSSGPNRQVLPSEPSNFMTLMGQNGALLTVWALAKRNWLWAYPNIYSQDFGNIRNWKMEPGKHREYFRFVNQSLGTCVEAYGNGLIHDICSLDKLAQEFELLPTDSGAVVIKSVSQGRCVTYNPVSTTFYSTVTLSVCDGATEPSRDQTWYLAPPVLEATAVN"	"reviewed"	"{'taxId': '233412', 'scientificName': 'Haemophilus ducreyi (strain 35000HP / ATCC 700724)', 'fullName': 'Haemophilus ducreyi (strain 35000HP / ATCC 700724)'}"