General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K3VJJ1",
        "id": "FCK3_FUSPC",
        "source_organism": {
            "taxId": "1028729",
            "scientificName": "Fusarium pseudograminearum (strain CS3096)",
            "fullName": "Fusarium pseudograminearum (strain CS3096) (Wheat and barley crown-rot fungus)"
        },
        "name": "Probable glycosyltransferase FCK3",
        "description": [
            "Probable glycosyl transferase; part of the gene cluster that mediates the biosynthesis of cytokinins such as fusatin, fusatinic acids or 8-oxofusatin, known for their growth promoting and anti-senescence activities toward host plants (PubMed:28802024). FCK1 is a bifunctional enzyme that performs the first steps in the biosynthesis of Fusarium cytokinins (PubMed:28802024). It first condenses adenosine monophosphate (AMP) with dimethylallyl diphosphate (DMAPP) to yield isoprenyl adenosine monophosphate (PubMed:28802024). It then catalyzes the removal of the phosphoribose to produce isopentenylaldehyde (PubMed:28802024). The cytochrome P450 monooxygenase then converts isopentenylaldehyde to trans-zeatin (PubMed:28802024). A condensation step converts trans-zeatin to fusatin which is further modified to produce fusatinic acid (PubMed:28802024). The mechanism for oxidation of fusatin to fusatinic acid remains unknown (PubMed:28802024). 8-oxofusatin could be produced through several pathways, via direct oxygenation of fusatin, or via the 8-oxo-pentenyladenine intermediate which itself must arise from either the prenylation of 8-oxo-AMP by FCK1 and/or oxygenation of isopentenylaldehyde (PubMed:28802024). Both the FCK3 and FCK4 enzymes act downstream of the identified cytokinins to produce yet unidentified compounds (PubMed:28802024)"
        ],
        "length": 394,
        "sequence": "MHFAIPLEYQSELEATEPVDVGTDEEIISSIEQYRPVTSEKNIWAFWDSGILSMPSWCKRNVIGWARICGADWTIRVLDMKPNSPNHVLKFIDRDMLPEAFLSGTMDGHHTGQHSADFIRGPLLHHYGGVSMDVGCLLIRHIDRICWDLLADPDSPYEIAVPVLYDQTIANHFIAARKNNIFIEKWHQLFLHLWNGRTHQQGISDSPLLGFIKDIRYDDATDFHWDWSVPVPQFLEYIAQVLCWQRLCLIRDTGDGFKSSEYWQRNVLCIDSLNEVWGGEKTLGFDGIGPRMYNLLTTRLDADPDSTAYKDAYKLVWRLLTRSSFQKVTRAKNLTYTPHLGTLWDQNEGKDCIPGSFGELLRYGPVHFRQKRENIEQLEASEPRTLIEKGLLEV",
        "proteome": "UP000007978",
        "gene": "FCK3",
        "go_terms": [
            {
                "identifier": "GO:0016757",
                "name": "glycosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a31fa28f47baafa628093a73fe1ddda3e5efbc80",
        "counters": {
            "domain_architectures": 2794,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2794
        }
    }
}