"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K3VJJ1"	"{'domain_architectures': 2794, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2794}"	"['Probable glycosyl transferase; part of the gene cluster that mediates the biosynthesis of cytokinins such as fusatin, fusatinic acids or 8-oxofusatin, known for their growth promoting and anti-senescence activities toward host plants (PubMed:28802024). FCK1 is a bifunctional enzyme that performs the first steps in the biosynthesis of Fusarium cytokinins (PubMed:28802024). It first condenses adenosine monophosphate (AMP) with dimethylallyl diphosphate (DMAPP) to yield isoprenyl adenosine monophosphate (PubMed:28802024). It then catalyzes the removal of the phosphoribose to produce isopentenylaldehyde (PubMed:28802024). The cytochrome P450 monooxygenase then converts isopentenylaldehyde to trans-zeatin (PubMed:28802024). A condensation step converts trans-zeatin to fusatin which is further modified to produce fusatinic acid (PubMed:28802024). The mechanism for oxidation of fusatin to fusatinic acid remains unknown (PubMed:28802024). 8-oxofusatin could be produced through several pathways, via direct oxygenation of fusatin, or via the 8-oxo-pentenyladenine intermediate which itself must arise from either the prenylation of 8-oxo-AMP by FCK1 and/or oxygenation of isopentenylaldehyde (PubMed:28802024). Both the FCK3 and FCK4 enzymes act downstream of the identified cytokinins to produce yet unidentified compounds (PubMed:28802024)']"	"FCK3"	"[{'identifier': 'GO:0016757', 'name': 'glycosyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"FCK3_FUSPC"	"a31fa28f47baafa628093a73fe1ddda3e5efbc80"	True	False	False	394	"Probable glycosyltransferase FCK3"	2	"UP000007978"	"MHFAIPLEYQSELEATEPVDVGTDEEIISSIEQYRPVTSEKNIWAFWDSGILSMPSWCKRNVIGWARICGADWTIRVLDMKPNSPNHVLKFIDRDMLPEAFLSGTMDGHHTGQHSADFIRGPLLHHYGGVSMDVGCLLIRHIDRICWDLLADPDSPYEIAVPVLYDQTIANHFIAARKNNIFIEKWHQLFLHLWNGRTHQQGISDSPLLGFIKDIRYDDATDFHWDWSVPVPQFLEYIAQVLCWQRLCLIRDTGDGFKSSEYWQRNVLCIDSLNEVWGGEKTLGFDGIGPRMYNLLTTRLDADPDSTAYKDAYKLVWRLLTRSSFQKVTRAKNLTYTPHLGTLWDQNEGKDCIPGSFGELLRYGPVHFRQKRENIEQLEASEPRTLIEKGLLEV"	"reviewed"	"{'taxId': '1028729', 'scientificName': 'Fusarium pseudograminearum (strain CS3096)', 'fullName': 'Fusarium pseudograminearum (strain CS3096) (Wheat and barley crown-rot fungus)'}"