HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H9L478",
"id": "PDUJ_SALTY",
"source_organism": {
"taxId": "99287",
"scientificName": "Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)",
"fullName": "Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)"
},
"name": "Bacterial microcompartment shell protein PduJ",
"description": [
"One of the major shell proteins of the bacterial microcompartment (BMC) dedicated to 1,2-propanediol (1,2-PD) degradation. The isolated BMC shell component protein ratio for J:A:B':B:K:T:U is approximately 15:10:7:6:1:1:2 (PubMed:12923081). At least one of PduA or PduJ is required for BMC assembly; it must be encoded as the first gene in the pdu operon (PubMed:27561553, PubMed:33227310). Required for structural integrity of BMCs and to mitigate propionaldehyde toxicity, probably joins facets responsible for BMC closure (PubMed:21239588). Edge residues (particularly Lys-25) are important for function and assembly of the BMC (PubMed:24747050). 80% identical to PduA; although their pore regions appear structurally identical, unlike PduA plays no role in 1,2-PD diffusion into or out of the BMC shell. If pduJ is cloned in the chromosomal position of pduA it is able to complement a pduA deletion; it then has a functional pore as it assumes the transport functions of PduA (PubMed:27561553). Overexpression of this protein leads to aberrant filaments that extend the length of the cell, cross the cleavage furrow and impair division. The filaments form nanotubes with a hollow center (PubMed:33227310). Modeling suggests PduJ is probably the hub for binding multiple enzymes to the interior of the BMC; modeling suggests PduC, PduD, PduG and PduM are targeted to PduJ (Probable)",
"The 1,2-propanediol (1,2-PD) degradation bacterial microcompartment (BMC) concentrates low levels of 1,2-PD catabolic enzymes, concentrates volatile reaction intermediates thus enhancing pathway flux and keeps the level of toxic, mutagenic propionaldehyde low"
],
"length": 91,
"sequence": "MNNALGLVETKGLVGAIEAADAMVKSANVQLVGYEKIGSGLVTVMVRGDVGAVKAAVDAGSAAASVVGEVKSCHVIPRPHSDVEAILPKSA",
"proteome": "UP000001014",
"gene": "pduJ",
"go_terms": [
{
"identifier": "GO:0031469",
"name": "bacterial microcompartment",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "994f802cb1dd605cbf7f1b3cbd800e31e7ab5d2c",
"counters": {
"domain_architectures": 14669,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 1,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"profile": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14669
}
}
}
