"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H9L478"	"{'domain_architectures': 14669, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 1, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'smart': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'profile': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14669}"	"[""One of the major shell proteins of the bacterial microcompartment (BMC) dedicated to 1,2-propanediol (1,2-PD) degradation. The isolated BMC shell component protein ratio for J:A:B':B:K:T:U is approximately 15:10:7:6:1:1:2 (PubMed:12923081). At least one of PduA or PduJ is required for BMC assembly; it must be encoded as the first gene in the pdu operon (PubMed:27561553, PubMed:33227310). Required for structural integrity of BMCs and to mitigate propionaldehyde toxicity, probably joins facets responsible for BMC closure (PubMed:21239588). Edge residues (particularly Lys-25) are important for function and assembly of the BMC (PubMed:24747050). 80% identical to PduA; although their pore regions appear structurally identical, unlike PduA plays no role in 1,2-PD diffusion into or out of the BMC shell. If pduJ is cloned in the chromosomal position of pduA it is able to complement a pduA deletion; it then has a functional pore as it assumes the transport functions of PduA (PubMed:27561553). Overexpression of this protein leads to aberrant filaments that extend the length of the cell, cross the cleavage furrow and impair division. The filaments form nanotubes with a hollow center (PubMed:33227310). Modeling suggests PduJ is probably the hub for binding multiple enzymes to the interior of the BMC; modeling suggests PduC, PduD, PduG and PduM are targeted to PduJ (Probable)"", 'The 1,2-propanediol (1,2-PD) degradation bacterial microcompartment (BMC) concentrates low levels of 1,2-PD catabolic enzymes, concentrates volatile reaction intermediates thus enhancing pathway flux and keeps the level of toxic, mutagenic propionaldehyde low']"	"pduJ"	"[{'identifier': 'GO:0031469', 'name': 'bacterial microcompartment', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"PDUJ_SALTY"	"994f802cb1dd605cbf7f1b3cbd800e31e7ab5d2c"	True	False	False	91	"Bacterial microcompartment shell protein PduJ"	1	"UP000001014"	"MNNALGLVETKGLVGAIEAADAMVKSANVQLVGYEKIGSGLVTVMVRGDVGAVKAAVDAGSAAASVVGEVKSCHVIPRPHSDVEAILPKSA"	"reviewed"	"{'taxId': '99287', 'scientificName': 'Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)', 'fullName': 'Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)'}"