{"metadata":{"accession":"H9L478","id":"PDUJ_SALTY","source_organism":{"taxId":"99287","scientificName":"Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)","fullName":"Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)"},"name":"Bacterial microcompartment shell protein PduJ","description":["One of the major shell proteins of the bacterial microcompartment (BMC) dedicated to 1,2-propanediol (1,2-PD) degradation. The isolated BMC shell component protein ratio for J:A:B':B:K:T:U is approximately 15:10:7:6:1:1:2 (PubMed:12923081). At least one of PduA or PduJ is required for BMC assembly; it must be encoded as the first gene in the pdu operon (PubMed:27561553, PubMed:33227310). Required for structural integrity of BMCs and to mitigate propionaldehyde toxicity, probably joins facets responsible for BMC closure (PubMed:21239588). Edge residues (particularly Lys-25) are important for function and assembly of the BMC (PubMed:24747050). 80% identical to PduA; although their pore regions appear structurally identical, unlike PduA plays no role in 1,2-PD diffusion into or out of the BMC shell. If pduJ is cloned in the chromosomal position of pduA it is able to complement a pduA deletion; it then has a functional pore as it assumes the transport functions of PduA (PubMed:27561553). Overexpression of this protein leads to aberrant filaments that extend the length of the cell, cross the cleavage furrow and impair division. The filaments form nanotubes with a hollow center (PubMed:33227310). Modeling suggests PduJ is probably the hub for binding multiple enzymes to the interior of the BMC; modeling suggests PduC, PduD, PduG and PduM are targeted to PduJ (Probable)","The 1,2-propanediol (1,2-PD) degradation bacterial microcompartment (BMC) concentrates low levels of 1,2-PD catabolic enzymes, concentrates volatile reaction intermediates thus enhancing pathway flux and keeps the level of toxic, mutagenic propionaldehyde low"],"length":91,"sequence":"MNNALGLVETKGLVGAIEAADAMVKSANVQLVGYEKIGSGLVTVMVRGDVGAVKAAVDAGSAAASVVGEVKSCHVIPRPHSDVEAILPKSA","proteome":"UP000001014","gene":"pduJ","go_terms":[{"identifier":"GO:0031469","name":"bacterial microcompartment","category":{"code":"C","name":"cellular_component"}}],"protein_evidence":1,"source_database":"reviewed","is_fragment":false,"in_alphafold":true,"in_bfvd":false,"ida_accession":"994f802cb1dd605cbf7f1b3cbd800e31e7ab5d2c","counters":{"domain_architectures":14669,"entries":13,"isoforms":0,"proteomes":1,"sets":1,"structures":1,"taxa":1,"dbEntries":{"cathgene3d":1,"smart":1,"ssf":1,"pfam":1,"cdd":1,"profile":1,"panther":1,"prosite":1,"interpro":5},"proteome":1,"taxonomy":1,"similar_proteins":14669}}}