General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2CMX6",
        "id": "H2CMX6_LEPCL",
        "source_organism": {
            "taxId": "48087",
            "scientificName": "Lepus californicus",
            "fullName": "Lepus californicus (Black-tailed jackrabbit)"
        },
        "name": "Atypical chemokine receptor 1",
        "description": [
            "Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels"
        ],
        "length": 291,
        "sequence": "SYNENESFDYNADLEAAAPCHSCNLLDDSSLPFFILASVLGILASGAVLFALLRPLFHWQLCPGRPILAQLAVGSALFSIVVPILAPGLSSAHSIILCGLGYWVWYGSAFAQALLIGCRACLGPKLGAGQSPXLTLGLTVGIWVAAALLGLPITLASDTSRGLCTLASSRGLGALQSTHAVACFVVFILWPLGLMGAKGLRKALGWGPGPWVDILWVWFIFWWPHGIFLGLDTLVRFRIILLPTCLVQKVLDLLLHLAEALAILHCVATPLLLALFCHQATRSSLPSLPLA",
        "proteome": null,
        "gene": "DARC",
        "go_terms": [
            {
                "identifier": "GO:0019956",
                "name": "chemokine binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006954",
                "name": "inflammatory response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0070098",
                "name": "chemokine-mediated signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1
        }
    }
}