"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H2CMX6"	"{'domain_architectures': 0, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'panther': 1, 'prints': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1}"	"['Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels']"	"DARC"	"[{'identifier': 'GO:0019956', 'name': 'chemokine binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006954', 'name': 'inflammatory response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0070098', 'name': 'chemokine-mediated signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"H2CMX6_LEPCL"	""	False	False	True	291	"Atypical chemokine receptor 1"	3	""	"SYNENESFDYNADLEAAAPCHSCNLLDDSSLPFFILASVLGILASGAVLFALLRPLFHWQLCPGRPILAQLAVGSALFSIVVPILAPGLSSAHSIILCGLGYWVWYGSAFAQALLIGCRACLGPKLGAGQSPXLTLGLTVGIWVAAALLGLPITLASDTSRGLCTLASSRGLGALQSTHAVACFVVFILWPLGLMGAKGLRKALGWGPGPWVDILWVWFIFWWPHGIFLGLDTLVRFRIILLPTCLVQKVLDLLLHLAEALAILHCVATPLLLALFCHQATRSSLPSLPLA"	"unreviewed"	"{'taxId': '48087', 'scientificName': 'Lepus californicus', 'fullName': 'Lepus californicus (Black-tailed jackrabbit)'}"