General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0VS35",
        "id": "H0VS35_CAVPO",
        "source_organism": {
            "taxId": "10141",
            "scientificName": "Cavia porcellus",
            "fullName": "Cavia porcellus (Guinea pig)"
        },
        "name": "Single-stranded DNA binding protein Ssb-like OB fold domain-containing protein",
        "description": [
            "Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways"
        ],
        "length": 227,
        "sequence": "MRVREGLAMGYRGSGSMTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAGQNDSSPTATQAATGSSAVSPASESQNGNGLSTPPGPGGGSHPPHTPSHPPSTRITRSQPNHTAAGPPGSSSNPVSNGKETRRSSKR",
        "proteome": "UP000005447",
        "gene": "NABP2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b9921ba051ffc3e44a66b601d2df132d0be5617b",
        "counters": {
            "domain_architectures": 4583,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4583
        }
    }
}