"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H0VS35"	"{'domain_architectures': 4583, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4583}"	"['Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways']"	"NABP2"	""	"H0VS35_CAVPO"	"b9921ba051ffc3e44a66b601d2df132d0be5617b"	True	False	False	227	"Single-stranded DNA binding protein Ssb-like OB fold domain-containing protein"	3	"UP000005447"	"MRVREGLAMGYRGSGSMTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAGQNDSSPTATQAATGSSAVSPASESQNGNGLSTPPGPGGGSHPPHTPSHPPSTRITRSQPNHTAAGPPGSSSNPVSNGKETRRSSKR"	"unreviewed"	"{'taxId': '10141', 'scientificName': 'Cavia porcellus', 'fullName': 'Cavia porcellus (Guinea pig)'}"