General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G9KN36",
        "id": "G9KN36_MUSPF",
        "source_organism": {
            "taxId": "9669",
            "scientificName": "Mustela putorius furo",
            "fullName": "Mustela putorius furo (European domestic ferret)"
        },
        "name": "Methionine-R-sulfoxide reductase B1",
        "description": [
            "Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Acts as a regulator of actin assembly by reducing methionine (R)-sulfoxide mediated by MICALs (MICAL1, MICAL2 or MICAL3) on actin, thereby promoting filament repolymerization. Plays a role in innate immunity by reducing oxidized actin, leading to actin repolymerization in macrophages"
        ],
        "length": 94,
        "sequence": "MSFCSFSGGEIFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPERNSPDALKVSCGRCGNGLGHEFLNDGPKPGQSRF",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0033743",
                "name": "peptide-methionine (R)-S-oxide reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "deb4c5e8efd21b1ddf07e78fdbd67304e03e4fcf",
        "counters": {
            "domain_architectures": 33949,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33949
        }
    }
}