GET /api/protein/UniProt/G9KN36/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G9KN36",
"id": "G9KN36_MUSPF",
"source_organism": {
"taxId": "9669",
"scientificName": "Mustela putorius furo",
"fullName": "Mustela putorius furo (European domestic ferret)"
},
"name": "Methionine-R-sulfoxide reductase B1",
"description": [
"Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Acts as a regulator of actin assembly by reducing methionine (R)-sulfoxide mediated by MICALs (MICAL1, MICAL2 or MICAL3) on actin, thereby promoting filament repolymerization. Plays a role in innate immunity by reducing oxidized actin, leading to actin repolymerization in macrophages"
],
"length": 94,
"sequence": "MSFCSFSGGEIFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPERNSPDALKVSCGRCGNGLGHEFLNDGPKPGQSRF",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0033743",
"name": "peptide-methionine (R)-S-oxide reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "deb4c5e8efd21b1ddf07e78fdbd67304e03e4fcf",
"counters": {
"domain_architectures": 33949,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 33949
}
}
}