"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G9KN36"	"{'domain_architectures': 33949, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 33949}"	"['Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Acts as a regulator of actin assembly by reducing methionine (R)-sulfoxide mediated by MICALs (MICAL1, MICAL2 or MICAL3) on actin, thereby promoting filament repolymerization. Plays a role in innate immunity by reducing oxidized actin, leading to actin repolymerization in macrophages']"	""	"[{'identifier': 'GO:0033743', 'name': 'peptide-methionine (R)-S-oxide reductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G9KN36_MUSPF"	"deb4c5e8efd21b1ddf07e78fdbd67304e03e4fcf"	True	False	True	94	"Methionine-R-sulfoxide reductase B1"	2	""	"MSFCSFSGGEIFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPERNSPDALKVSCGRCGNGLGHEFLNDGPKPGQSRF"	"unreviewed"	"{'taxId': '9669', 'scientificName': 'Mustela putorius furo', 'fullName': 'Mustela putorius furo (European domestic ferret)'}"