HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G7MQA4",
"id": "G7MQA4_MACMU",
"source_organism": {
"taxId": "9544",
"scientificName": "Macaca mulatta",
"fullName": "Macaca mulatta (Rhesus macaque)"
},
"name": "JNK pathway associated phosphatase",
"description": [
"Dual specificity phosphatase; can dephosphorylate both phosphotyrosine and phosphoserine or phosphothreonine residues. Activates the JNK signaling pathway. Inhibits T-cell receptor signaling and T-cell mediated immune responses, acting, at least in part, by inducing degradation of E3 ubiquitin ligase UBR2. Dephosphorylates and thereby induces 'Lys-48'-linked ubiquitination of UBR2, leading to proteasomal degradation of UBR2. Dephosphorylates and thereby inactivates tyrosine kinase LCK. Inhibits UBR2-mediated 'Lys-63'-linked ubiquitination of LCK. May play a role in B-cell receptor (BCR) signaling and B-cell function"
],
"length": 198,
"sequence": "ILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLREEYGESPLQDAEEAKSILGKYKEQGRVEPQPGARRWSSFPALAPLAYDNYTTET",
"proteome": null,
"gene": "EGK_14403",
"go_terms": [
{
"identifier": "GO:0006470",
"name": "protein dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016311",
"name": "dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15742d355813370d995348f784781e84405a14d7",
"counters": {
"domain_architectures": 53529,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"ssf": 1,
"profile": 2,
"cdd": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 53529
}
}
}