"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G7MQA4"	"{'domain_architectures': 53529, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'ssf': 1, 'profile': 2, 'cdd': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 53529}"	"[""Dual specificity phosphatase; can dephosphorylate both phosphotyrosine and phosphoserine or phosphothreonine residues. Activates the JNK signaling pathway. Inhibits T-cell receptor signaling and T-cell mediated immune responses, acting, at least in part, by inducing degradation of E3 ubiquitin ligase UBR2. Dephosphorylates and thereby induces 'Lys-48'-linked ubiquitination of UBR2, leading to proteasomal degradation of UBR2. Dephosphorylates and thereby inactivates tyrosine kinase LCK. Inhibits UBR2-mediated 'Lys-63'-linked ubiquitination of LCK. May play a role in B-cell receptor (BCR) signaling and B-cell function""]"	"EGK_14403"	"[{'identifier': 'GO:0006470', 'name': 'protein dephosphorylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016311', 'name': 'dephosphorylation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G7MQA4_MACMU"	"15742d355813370d995348f784781e84405a14d7"	True	False	True	198	"JNK pathway associated phosphatase"	3	""	"ILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLREEYGESPLQDAEEAKSILGKYKEQGRVEPQPGARRWSSFPALAPLAYDNYTTET"	"unreviewed"	"{'taxId': '9544', 'scientificName': 'Macaca mulatta', 'fullName': 'Macaca mulatta (Rhesus macaque)'}"