GET /api/protein/UniProt/F7I7E4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7I7E4",
"id": "F7I7E4_CALJA",
"source_organism": {
"taxId": "9483",
"scientificName": "Callithrix jacchus",
"fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
},
"name": "Regulator of chromosome condensation",
"description": [
"Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis. Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis. Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA"
],
"length": 456,
"sequence": "MPPKRIAKRKSPPEDAIPKNKKVKGARAAAFFAASCCVPGAHSCQGACGPGPPDQKTRPVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVTVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVRFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLSVSSGGQHTVLLVKDKEQS",
"proteome": "UP000008225",
"gene": "RCC1",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dcfb3b90e34dacdf24d74323772bac8be4b5cb3b",
"counters": {
"domain_architectures": 15879,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15879
}
}
}