"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F7I7E4"	"{'domain_architectures': 15879, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'prosite': 2, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 15879}"	"['Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis. Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis. Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA']"	"RCC1"	""	"F7I7E4_CALJA"	"dcfb3b90e34dacdf24d74323772bac8be4b5cb3b"	True	False	False	456	"Regulator of chromosome condensation"	4	"UP000008225"	"MPPKRIAKRKSPPEDAIPKNKKVKGARAAAFFAASCCVPGAHSCQGACGPGPPDQKTRPVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVTVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVRFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLSVSSGGQHTVLLVKDKEQS"	"unreviewed"	"{'taxId': '9483', 'scientificName': 'Callithrix jacchus', 'fullName': 'Callithrix jacchus (White-tufted-ear marmoset)'}"
