HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6RLS7",
"id": "F6RLS7_MONDO",
"source_organism": {
"taxId": "13616",
"scientificName": "Monodelphis domestica",
"fullName": "Monodelphis domestica (Gray short-tailed opossum)"
},
"name": "Ventral anterior homeobox 2",
"description": [
"Transcription factor that may function in dorsoventral specification of the forebrain. Regulates the expression of Wnt signaling antagonists including the expression of a truncated TCF7L2 isoform that cannot bind CTNNB1 and acts therefore as a potent dominant-negative Wnt antagonist. Plays a crucial role in eye development and, in particular, in the specification of the ventral optic vesicle. May be a regulator of axial polarization in the retina"
],
"length": 343,
"sequence": "MLAPAAAAAAGSMGDGGAEQGRGPIELASAERMRDLGSRAELGSTGRTGDWASGGAEGGGGGGREGGGGGGSRGLKDVAGTSATSPPAGSKTTCTESERQAGANEADYCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDSEKHSSTSTSEAFATSNILRLLEQGRLLSVPGASSLLALTSTPPGLTTSNGATPLGLPRNSSSNLTGTSPTESPPKAGATFGLIGPQMASTSTSPRLPPPPPPLCFTTTPLLDLPSGYELGTSAFEPYSRLERKNSGPGSKKANTT",
"proteome": "UP000002280",
"gene": "VAX2",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000981",
"name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1cca9db9652b5e6e0313f2eed7be72cec278d12f",
"counters": {
"domain_architectures": 145457,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 145457
}
}
}