"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F6RLS7"	"{'domain_architectures': 145457, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 145457}"	"['Transcription factor that may function in dorsoventral specification of the forebrain. Regulates the expression of Wnt signaling antagonists including the expression of a truncated TCF7L2 isoform that cannot bind CTNNB1 and acts therefore as a potent dominant-negative Wnt antagonist. Plays a crucial role in eye development and, in particular, in the specification of the ventral optic vesicle. May be a regulator of axial polarization in the retina']"	"VAX2"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000981', 'name': 'DNA-binding transcription factor activity, RNA polymerase II-specific', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F6RLS7_MONDO"	"1cca9db9652b5e6e0313f2eed7be72cec278d12f"	True	False	False	343	"Ventral anterior homeobox 2"	3	"UP000002280"	"MLAPAAAAAAGSMGDGGAEQGRGPIELASAERMRDLGSRAELGSTGRTGDWASGGAEGGGGGGREGGGGGGSRGLKDVAGTSATSPPAGSKTTCTESERQAGANEADYCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDSEKHSSTSTSEAFATSNILRLLEQGRLLSVPGASSLLALTSTPPGLTTSNGATPLGLPRNSSSNLTGTSPTESPPKAGATFGLIGPQMASTSTSPRLPPPPPPLCFTTTPLLDLPSGYELGTSAFEPYSRLERKNSGPGSKKANTT"	"unreviewed"	"{'taxId': '13616', 'scientificName': 'Monodelphis domestica', 'fullName': 'Monodelphis domestica (Gray short-tailed opossum)'}"