HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4JFD2",
"id": "B4JFD2_DROGR",
"source_organism": {
"taxId": "7222",
"scientificName": "Drosophila grimshawi",
"fullName": "Drosophila grimshawi (Hawaiian fruit fly)"
},
"name": "Actin-related protein 2/3 complex subunit 3",
"description": [
"Component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs)",
"Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks"
],
"length": 177,
"sequence": "MPAYHSQIKDFRQQVGNMAILPLRTQVRGPAPSANVDSDIIDESLYFFKANVFFRTYEVKSEVDRVLIYITLYITECLKRLTRITSKAQGQQEMYSLAISKFDIPGDAGFPLNSVYAKPQTAQDADLMRQYLLQLRHETGNRVVEKVFSTEDGRPNKWWTCFAKKKFMEKSLAGPGQ",
"proteome": "UP000001070",
"gene": "Dgri\\GH19295",
"go_terms": [
{
"identifier": "GO:0034314",
"name": "Arp2/3 complex-mediated actin nucleation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005856",
"name": "cytoskeleton",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005885",
"name": "Arp2/3 protein complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d1017cf1b80e248e2fdb9c261faafb37841a752a",
"counters": {
"domain_architectures": 4324,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pirsf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4324
}
}
}
